PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G218900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 321aa    MW: 34872.5 Da    PI: 8.9882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G218900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.6e-131863146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +g+WT+eEde l++ v+++G++ W++I ++  + Rt+k+c++rw +
  Sevir.6G218900.1.p 18 KGPWTAEEDEVLLRHVREHGPREWSSIRSKGLLPRTGKSCRLRWVN 63
                        79*************************8876677**********87 PP

2Myb_DNA-binding42.61.4e-1374114345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Sevir.6G218900.1.p  74 KFSAEEERVVLELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 114
                         79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-211266IPR009057Homeodomain-like
PROSITE profilePS5129421.9031369IPR017930Myb domain
SuperFamilySSF466892.88E-2816113IPR009057Homeodomain-like
SMARTSM007173.5E-121767IPR001005SANT/Myb domain
CDDcd001675.82E-132065No hitNo description
PfamPF139214.2E-122171No hitNo description
Gene3DG3DSA:1.10.10.603.0E-1867119IPR009057Homeodomain-like
PROSITE profilePS5129417.92470121IPR017930Myb domain
SMARTSM007175.2E-1271119IPR001005SANT/Myb domain
CDDcd001671.23E-1074113No hitNo description
PfamPF002497.6E-1274114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MKPRGGRGGG SEQPAVRKGP WTAEEDEVLL RHVREHGPRE WSSIRSKGLL PRTGKSCRLR  60
WVNKLRPDLK TGCKFSAEEE RVVLELQAQF GNKWARIATY LPGRTDNDVK NFWSTRQKRL  120
ARLLRAPMPR RRPGKQSCGA SSSHAYELPA PKSPCMEMIP FQETTTTHRI GESSSSSQEP  180
TTANQHTAAA HFPGAYGLPP PPIPLPIMHA GAERGSSGAC PTTALLLPYG SGTGNPVNGV  240
DPLVFVDPAA SPEPLEVVPR GPFFGLDDAY VHAGRALHGD VGGVRFDDLP PETFDFFELP  300
HLPAFPPPFP PPPPSPSDQL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281411923126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630001e-36AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316131e-36AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149601e-36AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-36CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552181e-36CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445870.11e-104hypothetical protein SORBIDRAFT_07g027160
TrEMBLK3YNH40.0K3YNH4_SETIT; Uncharacterized protein
STRINGSi015815m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-61MYB family protein